PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof007708
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 313aa    MW: 34181.3 Da    PI: 4.67
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-569133732PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-202477356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  Sof007708 24 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 77
               5678*************************************************9 PP

2HD-ZIP_I/II130.85.3e-4223114192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk++++al+++++ L +++++Lr+++ 
    Sof007708  23 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFEALRADHDVLLQDNHRLRSQVV 114
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.221979IPR001356Homeobox domain
SuperFamilySSF466896.94E-202081IPR009057Homeodomain-like
SMARTSM003892.0E-202283IPR001356Homeobox domain
PfamPF000467.1E-182477IPR001356Homeobox domain
CDDcd000862.20E-202480No hitNo description
Gene3DG3DSA:1.10.10.607.7E-222586IPR009057Homeodomain-like
PRINTSPR000311.9E-65059IPR000047Helix-turn-helix motif
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PRINTSPR000311.9E-65975IPR000047Helix-turn-helix motif
PfamPF021837.9E-1779121IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
NXTFFTSPDE LLEEEYYDEQ LPEKKRRLTP EQVHLLERSF EEENKLEPER KTELARKLGL  60
QPRQVAVWFQ NRRARWKTKQ LERDFDRLKA SFEALRADHD VLLQDNHRLR SQVVSLTEKL  120
QEKEATEGGA SAATDAAALP AVDDVKASLA DGVEEPTEPA EGAAAFEVQQ VKSEDRLSTG  180
SGGSAVVDAD ALLYGAGGRF AAAVDSSVES YFPGGEDHHY HDCGMGPVNH GAGGGIQSDD  240
DGAAATRDAA TTPRKTPPRR RFFLGHTPHH VDNDEDAGLS AAGGGPDDNS FVCDRPSKIF  300
SPYMISVGIS LCT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17179RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.180181e-57crown| inflorescence| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130421.11e-131uncharacterized protein LOC100191517
SwissprotQ6YWR41e-104HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
SwissprotA2X9801e-104HOX16_ORYSI; Homeobox-leucine zipper protein HOX16
TrEMBLB4F9281e-131B4F928_MAIZE; Uncharacterized protein
STRINGSb04g029080.11e-136(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.19e-57homeobox 1